Protein Info for LRK55_RS13190 in Rhodanobacter denitrificans MT42

Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 4 to 325 (322 residues), 251.1 bits, see alignment E=1.4e-78 PF00460: Flg_bb_rod" amino acids 5 to 34 (30 residues), 30 bits, see alignment (E = 6e-11) PF21158: flgK_1st_1" amino acids 333 to 410 (78 residues), 34.9 bits, see alignment E=1.9e-12 PF06429: Flg_bbr_C" amino acids 574 to 619 (46 residues), 35.3 bits, see alignment 1.5e-12

Best Hits

KEGG orthology group: None (inferred from 43% identity to xop:PXO_06163)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (624 amino acids)

>LRK55_RS13190 flagellar hook-associated protein FlgK (Rhodanobacter denitrificans MT42)
MADMLSTGVSGLLAAQIGLSTVSHNVANANTDGYSRQLVSYAARLPEGQANYYVGTGVNT
VAVQRAYSQFLNSSLWSATSAQGRASSMASLTGQLNDQLSGNSNLQTSLDSFFGAVQDMA
NAPSDAASRQVLLARAGGLASTFRALSGQFNQLSGQVQQQIGEAVDAINSDSQSIARLNG
LIRSSQATDGTPPADLLDQRDALVKKLAGQVGISVVPQNDNTLSVFVGNGQALVTGTEAH
ALGTAPNMYDATRLEVVGAASGAVLSGRIGGGTLGALLDFRGNVLDPAQNQLGRAAQALA
SAFNAQHAQGMDLRGELGGTFFDVAGPTVQAAASNSGSGTLGAAIGAIGALTGKDYVLSY
DGSAWRMRDTSGNSVVLAGSGTSADPFVAAGLSLVVGGSANAGDSFRVQPSRNAAASFSV
AIDDPDKVAAAAPLKATAAAGNTGTAAAAVSVSDGSNPNLFNSSSVVFASTTSYSIDGGP
AQVFTPGQPIVHNGWSLRFGGAPQAGDSFGVQANSNAQGDNSNALMLGKVANLGVLDGGV
TSAGRAYSQLVGQVGSAGALAKDDLTTQTAVYHQAMSSQQSVSGVNLDEEAANLLRYQQA
YQASAQVISTANNIFGALLSAVKG