Protein Info for LRK55_RS13085 in Rhodanobacter denitrificans MT42

Annotation: pantetheine-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 7 to 66 (60 residues), 48.9 bits, E=5.6e-17
• TIGR01510: pantetheine-phosphate adenylyltransferase
  • amino acids 7 to 159 (153 residues), 182 bits, E=7.7e-58
• PF01467: CTP_transf_like
  • amino acids 8 to 136 (129 residues), 94.6 bits, E=3e-31

Best Hits

Swiss-Prot: 75% identical to COAD_XANC5: Phosphopantetheine adenylyltransferase (coaD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 76% identity to psu:Psesu_1193)

MetaCyc: 58% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• coenzyme A biosynthesis III (archaea) (3/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Protein Sequence (179 amino acids)

>LRK55_RS13085 pantetheine-phosphate adenylyltransferase (Rhodanobacter denitrificans MT42)
MGNPRLAVYPGTFDPITNGHTDLVTRAAPLFDKVVVAVADSSSKGPGFSIGERITLARLA
LADLPNVEVRGFDCLLATFVQEVGAGVIIRGLRAVSDFEYEFQLASMNRHLIPQAETLFL
TPAEQYSFISSSLVREIGRLGGDISGFVHPAVQQAMRQRWQKGRTGHNKQPETEGDHHA