Protein Info for LRK55_RS13080 in Rhodanobacter denitrificans MT42

Annotation: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 10 to 188 (179 residues), 170.6 bits, see alignment E=1.6e-54 PF03602: Cons_hypoth95" amino acids 12 to 187 (176 residues), 186.3 bits, see alignment E=4.5e-59 PF05175: MTS" amino acids 53 to 131 (79 residues), 32.4 bits, see alignment E=6.9e-12

Best Hits

Swiss-Prot: 35% identical to RSMD_BUCBP: Ribosomal RNA small subunit methyltransferase D (rsmD) from Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 57% identity to sml:Smlt1810)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>LRK55_RS13080 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (Rhodanobacter denitrificans MT42)
MNDMRRAAPGRIRIIGGSLRNSRLEVPNLPGLRPTAERVRETLFNWLAPVIDGARCLDLC
AGTGALGIEALSRGAAAVQFVERDARAAQALRANLARLKADGGQVAALEAEAFLRGTAQP
CDVVFLDPPFALELWPALARQLEQGGWLAARAWIYVESPRGPAPALPPNWQLHREGQAGE
VRFALYRRALPLS