Protein Info for LRK55_RS12630 in Rhodanobacter denitrificans MT42

Annotation: DUF2182 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details PF09948: DUF2182" amino acids 54 to 241 (188 residues), 142.7 bits, see alignment E=6.7e-46

Best Hits

KEGG orthology group: None (inferred from 55% identity to reh:H16_B0829)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>LRK55_RS12630 DUF2182 domain-containing protein (Rhodanobacter denitrificans MT42)
MVTLLFLASAAATIAGGATMSTMDGMPMPGGWTMSMVWLQLDGHSWPAAAVSFLGMWMAM
MVAMMLPSLMPVLWRCHQAFGDSGVARPGRLTAAVATGYFMAWLVCGVAVFPLGGMLATL
AMRLPLLARAVPVLAGMVVLAAGALQFSRWKARHLACCRGAPGFAQAVPRSAGRAWRRGL
RFGLHCNLCGVGLTASLLVIGVMDLRAMGAVFAGITLERLAPAGERMARVVGVVLVGAGA
VLLAQAIGRV