Protein Info for LRK55_RS12275 in Rhodanobacter denitrificans MT42

Annotation: IS3 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF13276: HTH_21" amino acids 39 to 85 (47 residues), 52.6 bits, see alignment 1.1e-17 PF00665: rve" amino acids 119 to 215 (97 residues), 78.1 bits, see alignment E=1.4e-25 PF13610: DDE_Tnp_IS240" amino acids 123 to 262 (140 residues), 38.4 bits, see alignment E=3.6e-13 PF13683: rve_3" amino acids 208 to 270 (63 residues), 50 bits, see alignment E=4.9e-17 PF13333: rve_2" amino acids 223 to 274 (52 residues), 44.5 bits, see alignment 3.5e-15

Best Hits

KEGG orthology group: None (inferred from 42% identity to cps:CPS_2962)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>LRK55_RS12275 IS3 family transposase (Rhodanobacter denitrificans MT42)
MQQQQEFHSVRLLCRLYGVSASGFYAWRDRPASSRSQEDARLLGKIRQIHDDSRQTYGSP
RVHTGLQGEGESVGRRRVERLMRDNAVRGCSADLYRRCPGVDRFFSSVDNQVHELTVDRT
DQVWVTDVTYLKVSGTWRYLATVMDRYSRRLLGWSLGSDRTARLTRRALAAALRQRKPPA
GTLLHSDRGVEFLASDFKQALASAGLVQSVNRPHRMTDNAHMESWNKSMKSDMYHRQNFT
SEHTLRAAVRSYIDFYNSKRLHSALGYRSPIEFEALAA