Protein Info for LRK55_RS12115 in Rhodanobacter denitrificans MT42

Annotation: LPS export ABC transporter permease LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 61 to 79 (19 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 4 to 355 (352 residues), 308.4 bits, see alignment E=2.5e-96 PF03739: LptF_LptG" amino acids 7 to 355 (349 residues), 197.4 bits, see alignment E=1.7e-62

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 41% identity to sml:Smlt0676)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>LRK55_RS12115 LPS export ABC transporter permease LptF (Rhodanobacter denitrificans MT42)
MLSILDRYFLRELAQTVTATVVVLLVVVAGSAFAKVLEQVANGSFPASVMFQVLGLRTLD
GLTNMLPLASFVGVLLGLGRMYRESEMHVLSSSGMGPRGLLRPVLLLGALLVALTALVSL
WLGPWAVRTSDALVAEANRSVIAAGLDAGRFTELPGKGGIIFVDSLSRDGSKLGRTFVAT
QSEGKNGPPHLKVVSATSGELYQESNGEGRFIAFKDGWQYDIPLGANNWRQMQYRRNDTS
LSSVQADDDDDPAHSKSSWALFRSDDPTDRAEFAWRANAPPLTFVLLLLALPLSRQSPRE
PKYGRLLLAVVTFYLYYTLLALGRAQIGKGHWHGEAPLWALHALVLALALWMLWKQYAPR
KLRKRRVLPGLPA