Protein Info for LRK55_RS11865 in Rhodanobacter denitrificans MT42

Annotation: methionine adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 3 to 101 (99 residues), 144.4 bits, E=2.1e-46
• TIGR01034: methionine adenosyltransferase
  • amino acids 5 to 393 (389 residues), 593.2 bits, E=1e-182
• PF02772: S-AdoMet_synt_M
  • amino acids 114 to 233 (120 residues), 154 bits, E=3e-49
• PF02773: S-AdoMet_synt_C
  • amino acids 235 to 366 (132 residues), 228.5 bits, E=3.5e-72

Best Hits

Swiss-Prot: 88% identical to METK_XANAC: S-adenosylmethionine synthase (metK) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 88% identity to xop:PXO_04686)

MetaCyc: 72% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• L-methionine salvage cycle I (bacteria and plants) (9/12 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• L-methionine salvage cycle II (plants) (7/11 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Protein Sequence (399 amino acids)

>LRK55_RS11865 methionine adenosyltransferase (Rhodanobacter denitrificans MT42)
MSNYLFTSESVSEGHPDKVADQISDAVLDAIIAQDPRARVACETMVKTGVAIVAGEITTS
AWIDLEAITRKVIVDIGYDSSNVGFDGATCGVINLIGKQSPDINQGVDRKNPEDQGAGDQ
GLMFGYATNETKDMMPAAIYYSHRLVEQQAKVRKRKNSPLPWLRPDAKSQVTLRYEHGVA
TAIDAVVLSTQHDPGVKQKDLIEAVREHILKPVLPAKLLHKGTKFHINPTGKFEIGGPVG
DCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGIADRCEVQ
VSYAIGVAHPTSISVTTFGTGKISDEKIEKLIRKHFDLRPYGILQMLDLIHPMYQQTASY
GHFGRTPHQMKGPDGKAFTAFSWEKTDRAEALRKDAKLK