Protein Info for LRK55_RS11790 in Rhodanobacter denitrificans MT42

Annotation: dipeptide epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 3 to 111 (109 residues), 42.3 bits, E=8.4e-15
• PF13378: MR_MLE_C
  • amino acids 134 to 295 (162 residues), 89 bits, E=3.8e-29

Best Hits

KEGG orthology group: None (inferred from 48% identity to pct:PC1_2867)

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

• catechol degradation III (ortho-cleavage pathway) (4/6 steps found)
• catechol degradation to β-ketoadipate (2/4 steps found)
• superpathway of salicylate degradation (4/7 steps found)
• aromatic compounds degradation via β-ketoadipate (5/9 steps found)
• mandelate degradation to acetyl-CoA (5/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.1

Protein Sequence (329 amino acids)

>LRK55_RS11790 dipeptide epimerase (Rhodanobacter denitrificans MT42)
MQTEVRHERWELAAPFVIAHETYLHADVIVATLSCDGAVGRGECTPTAFYGESVDGVMET
VRELLARLARGESWDRIHDHVPAGAARNAVDCACWDLRAKLAKRRVWELAGVPAPGQVRT
AQTISVGEAAQQADKARAIVVTDGDGALIKLKLDAHDVVARVAAVRDAAPAATLVIDANE
SWDPVLLDGVMPALQAAHVAMVEQPLPVGKDDALARIERRVPVCADESAHVGADLDALRG
RYDLVNVKLDKTGGLTEALRMTARARQLGFGLMVGCMEGTSLGMAPATLVAGAARFVDLD
GPLLIGRDRDPGLHYQRGLVSPPSAALWG