Protein Info for LRK55_RS11385 in Rhodanobacter denitrificans MT42

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 7 to 210 (204 residues), 218 bits, E=5.1e-69
• PF06026: Rib_5-P_isom_A
  • amino acids 49 to 211 (163 residues), 197.1 bits, E=9.1e-63

Best Hits

Swiss-Prot: 72% identical to RPIA_XANOM: Ribose-5-phosphate isomerase A (rpiA) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 73% identity to psu:Psesu_2645)

MetaCyc: 61% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (214 amino acids)

>LRK55_RS11385 ribose-5-phosphate isomerase RpiA (Rhodanobacter denitrificans MT42)
MSNANEKRQAGEAAIRYVEDGAIVGVGTGSTVAFFIDALADLKQRIQGAVSSSEQSTAQL
KKLGIPVLDLNATGPLTLYVDGADECDPYKRLIKGGGAALTREKIVAAASEKFVCIIDSS
KRVELLGKFPVPIEVIPMARSLIGREIVKRGGQPVWRDGVTTDNGNWIIDVHGWQIVDPA
ALESELNQLPGIVTVGLFARRPADVVLIGDQLMG