Protein Info for LRK55_RS11295 in Rhodanobacter denitrificans MT42

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF02885: Glycos_trans_3N" amino acids 11 to 72 (62 residues), 59.4 bits, see alignment E=2.3e-20 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 14 to 341 (328 residues), 409.2 bits, see alignment E=6.9e-127 PF00591: Glycos_transf_3" amino acids 83 to 332 (250 residues), 302.5 bits, see alignment E=2.8e-94

Best Hits

Swiss-Prot: 74% identical to TRPD_ACIAC: Anthranilate phosphoribosyltransferase (trpD) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 74% identity to aav:Aave_0585)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>LRK55_RS11295 anthranilate phosphoribosyltransferase (Rhodanobacter denitrificans MT42)
MSARAITITPQEALQRTIEHREIFHDEMIALMRQIMRGEVSPLMTAAIITGLRVKKETVG
EITGAARVMRELSAKVDVPAHAHFVDIVGTGGDGASSFNISTTAMFVAAAAGACIAKHGG
RSVSSKSGSADVLEALGAAIELPPAQVAACMAETGIGFMFAPNHHPAMKVVAPVRKEMGV
RTLFNILGPLTNPAGAPNILMGVFHPDLVGIQVRVLQQLGARHALVVWGRDGLDEISLGA
ATLVGELRDGVVREYEVEPEDFGLAMASSRNLRVENADESKAMLLEVLQGRHGVAHDIVC
LNAGAALYTADVATSVGEGIDLARATIASGAAHAKMQAFVAATRRLANPP