Protein Info for LRK55_RS10225 in Rhodanobacter denitrificans MT42

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01346: isocitrate lyase
  • amino acids 9 to 248 (240 residues), 354 bits, E=6.3e-110
  • amino acids 249 to 425 (177 residues), 281.5 bits, E=5.7e-88
• PF00463: ICL
  • amino acids 14 to 248 (235 residues), 192.7 bits, E=1.1e-60
  • amino acids 250 to 425 (176 residues), 161.1 bits, E=3.9e-51
• PF13714: PEP_mutase
  • amino acids 75 to 273 (199 residues), 57.3 bits, E=1.9e-19

Best Hits

Swiss-Prot: 72% identical to ACEA_BACHD: Isocitrate lyase (aceA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 88% identity to sml:Smlt0232)

MetaCyc: 69% identical to isocitrate lyase (Escherichia coli K-12 substr. MG1655)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Protein Sequence (431 amino acids)

>LRK55_RS10225 isocitrate lyase (Rhodanobacter denitrificans MT42)
MKTTLPTAEQITLDWNNNPRWTGVQRNYSAEDVARLRGTVAVEHSLARRGAERLWKSLHQ
EDFVNALGALTGNQAMQQVKAGLQAIYLSGWQVAADANVAGEMYPDQSLYPANSVPLVVK
RINNTLLRADQLHHAEGKDDCDWLVPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAVDKLNAARLAADVAGVPTLLVARTDADAADLLTSDIDA
NDRAFITGERTVEGFYRVRPGLDQAISRGLAYAPYADLIWCETSKPNLDDARRFAEAIHA
KFPGKLLAYNCSPSFNWKKNLDDATIANFQKELGAMGYKFQFITLAGFHSLNYGMFDLAH
GYARRQMSAFVELQEKEFAAAERGFTAVKHQREVGTGYFDQVTQAIQQGQSSTTALKGST
EEAQFKQASAA