Protein Info for LRK55_RS10095 in Rhodanobacter denitrificans MT42

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 160 to 176 (17 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 293 to 318 (26 residues), see Phobius details amino acids 338 to 366 (29 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details amino acids 448 to 470 (23 residues), see Phobius details amino acids 476 to 492 (17 residues), see Phobius details PF13520: AA_permease_2" amino acids 30 to 480 (451 residues), 188.9 bits, see alignment E=2.5e-59 PF00324: AA_permease" amino acids 35 to 463 (429 residues), 137.6 bits, see alignment E=8.2e-44 PF13906: AA_permease_C" amino acids 445 to 495 (51 residues), 35.5 bits, see alignment 1.3e-12

Best Hits

Predicted SEED Role

"amino acid transporter protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>LRK55_RS10095 amino acid permease (Rhodanobacter denitrificans MT42)
MGFFGKLVRHKTVEQLQAEAGTRGDFRRVLGLWQLTAIGIGGIIGVGIFVLAGQQAAANA
GPAVALSFLIAGIGSACAALCYAEFAGLIPVTGSAYTYGYAVLGEFAAWVIGWDLLLEYA
LVVAVVAIGWSGYVQVLLNSAGVHLPEWAQQSMSAQTMQYYLQQVFGAHGAGTIAAPSDG
HRFNVIAAAVSLAVAVLLTVRTEWGARFNTAVVAIKVIGVLLVVLVGVFYIDTANWHPFV
PPRVVDTATGIGHFGWQGVLTGASVVFFAVFGYDTLTTAAEESKNPQRDLPRAVLLSLAI
AMVLYIAVSLVLTGIAHYSTLGGEASVSDAFESIGLHWLSVTIAAAAVIGVTSVLFAFML
GAARIWFALARDGLLPTWFAKVSPRFGTPARPTLILGVFTALVAGLLPIGEVAELVNIGT
LSAFIIICASIMLLRVRRPDLQRNFRTPAVWFTAPLGIVFSVALIYGLPWITYERFIVWM
ALGCVIYFAYGIRRSKLAAAGG