Protein Info for LRK55_RS09885 in Rhodanobacter denitrificans MT42

Annotation: pimeloyl-ACP methyl ester esterase BioH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 77 to 94 (18 residues), see Phobius details TIGR01738: pimelyl-[acyl-carrier protein] methyl ester esterase" amino acids 10 to 250 (241 residues), 229.5 bits, see alignment E=2.4e-72 PF00561: Abhydrolase_1" amino acids 14 to 240 (227 residues), 72.9 bits, see alignment E=5e-24 PF12146: Hydrolase_4" amino acids 15 to 235 (221 residues), 44.7 bits, see alignment E=1.6e-15 PF12697: Abhydrolase_6" amino acids 15 to 247 (233 residues), 79.3 bits, see alignment E=1e-25

Best Hits

Swiss-Prot: 54% identical to BIOH_STRM5: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 54% identity to smt:Smal_3829)

MetaCyc: 35% identical to pimeloyl-acyl carrier protein methyl ester esterase (Escherichia coli K-12 substr. MG1655)
RXN-11483 [EC: 3.1.1.85]; Carboxylesterase. [EC: 3.1.1.85, 3.1.1.1]

Predicted SEED Role

"Biotin synthesis protein BioH"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1 or 3.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>LRK55_RS09885 pimeloyl-ACP methyl ester esterase BioH (Rhodanobacter denitrificans MT42)
MSLYVDRRGHGPVPLVLLHGWAMHGGVLAPLVEALEDQCTMYVVDLPGHGRSRDCGLPLE
PHACAAAIAKLTPPALWLGWSLGGTIALTAALELPRQVRGLAMLCATPKFVRDAGWPHGS
DAQLVHQLASDLETDYHATIERFLALEAMGSADPRGELRHLRELVFTHGEPDLRVLQEGI
RILESSDRRAALPDLAVRSAWISGRRDRLVPPQAMAWSASQCGGQYTEIPQAGHAPFFGH
ADAVAQALQPLLAPLSLEQAR