Protein Info for LRK55_RS09685 in Rhodanobacter denitrificans MT42

Annotation: TIGR03862 family flavoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03486: HI0933_like" amino acids 9 to 402 (394 residues), 355.2 bits, see alignment E=2.1e-110 TIGR00275: flavoprotein, HI0933 family" amino acids 10 to 402 (393 residues), 296.4 bits, see alignment E=3e-92 TIGR03862: flavoprotein, TIGR03862 family" amino acids 29 to 406 (378 residues), 540.2 bits, see alignment E=2.3e-166

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 67% identity to sml:Smlt1695)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>LRK55_RS09685 TIGR03862 family flavoprotein (Rhodanobacter denitrificans MT42)
MTRQASPRLAIIGGGPAGLMAAEAACAAGVAVDLYEAKGSVGRKFLLAGKGGLNLTHGEP
RARFVERYGARRDEVGRWLDAFDAEALRAWARGLGVETFAGSSGRVFPADLKAAPLLRGW
LRRLRESGVAFHVHHRWLGWSDGALRFATAQGERTLHAEATVLALGGASWPQLGSDGAWV
APLRQACIDVAPLQPANCGFELAWSEHLASRFAGAPLKPVVAHWVDRCGVARSRQGEFVL
SEYGIEGSLIYAIGAELREQIAERGEALLKLDLVPGYPEAVLAERLAAPRGRHSLGDWLR
RRAGLDKAKCALLFELADKAILADPATLATRLKALPLRLRAPRPVAEAISTAGGVRLEAL
DENLMLRARPGVFCAGEMLDWEAPTGGYLLTACFASGLLAGRAAARRLLGAG