Protein Info for LRK55_RS09670 in Rhodanobacter denitrificans MT42

Annotation: M20/M25/M40 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04389: Peptidase_M28" amino acids 113 to 315 (203 residues), 80 bits, see alignment E=2e-26 PF01546: Peptidase_M20" amino acids 146 to 305 (160 residues), 27.9 bits, see alignment E=2.1e-10

Best Hits

Swiss-Prot: 40% identical to M28P2_ARTGP: Probable zinc metalloprotease MGYG_02393 (MGYG_02393) from Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)

KEGG orthology group: None (inferred from 67% identity to cse:Cseg_3395)

Predicted SEED Role

"Leucine aminopeptidase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>LRK55_RS09670 M20/M25/M40 family metallo-hydrolase (Rhodanobacter denitrificans MT42)
MQLLPFILLAATGAGRAAQAPAAPREQPALHALAGAPSEAELRATIATLVGFGTRHTLSD
TKSDTRGIGAARRWVKSRFEAIARDCGGCIEVVTPAQAFSGKRMPTPTEVMDVVAIKRGK
RDPQRVIVMTGHLDSRVSDVMDASSDAPGANDDASGVAALIEAARLLSKQDNDATLVFAA
LSGEEQGLYGGKVLADYAAAHGWRVEADLNNDIVGNSRGQNGVADSSTVRVFSEGTRSNE
TPAQANYRRYHGGEVDSPSRNVARTMAALADAYLPDFRVRMVYRTDRYGRGGDQVPFLEA
GYPAVRVTEAHEDYTRQHQDLRTEHGIHYGDTIDGIDFRYLARVTALNTITMAALSRAPA
PPEGIDIAGAVATDTTLKWRKVPGAAGYRVHWRDTTAAKWQYARAVGDVDHAVLPDVVID
DWFFGVSSVSVDGYESPVVFPGDAGSFARSPAPAGQP