Protein Info for LRK55_RS09235 in Rhodanobacter denitrificans MT42

Annotation: haloacid dehalogenase type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR01428: haloacid dehalogenase, type II" amino acids 21 to 212 (192 residues), 195.6 bits, see alignment E=8.8e-62 PF00702: Hydrolase" amino acids 22 to 202 (181 residues), 78.4 bits, see alignment E=9.7e-26 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 22 to 199 (178 residues), 97.4 bits, see alignment E=1e-31 PF13419: HAD_2" amino acids 106 to 189 (84 residues), 32.8 bits, see alignment E=7.6e-12

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 51% identity to pgv:SL003B_2980)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>LRK55_RS09235 haloacid dehalogenase type II (Rhodanobacter denitrificans MT42)
MPIHDHDIPDVQRVDTAPPAIAVFDAYGTLFDVHSAMARLAGIVGPDAERISTLWRQKQL
EYSWTRSLMGRYVDFWQVTEEALDYALASFGRRDSVVRQALLDAYRRLDAYPDVREALGA
CRRLGLPVAVFSNATTAMLNTALTAAGLDDLVDIVYSVHALEMFKPDARAYAAAAKAFGA
VPSSIAFHSSNGWDAAGAASCGWRALWINRTGLPREYPWMDVPAVSGLGQALARIEASTA
VDAIRNTGQKDA