Protein Info for LRK55_RS08960 in Rhodanobacter denitrificans MT42

Annotation: pyridoxine/pyridoxal/pyridoxamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00687: pyridoxal kinase" amino acids 15 to 274 (260 residues), 162.3 bits, see alignment E=8.4e-52 PF08543: Phos_pyr_kin" amino acids 66 to 263 (198 residues), 75.9 bits, see alignment E=3.4e-25 PF00294: PfkB" amino acids 138 to 255 (118 residues), 44.2 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 56% identical to PDXK_CUPMC: Pyridoxine/pyridoxal/pyridoxamine kinase (pdxK) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 56% identity to rme:Rmet_4114)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>LRK55_RS08960 pyridoxine/pyridoxal/pyridoxamine kinase (Rhodanobacter denitrificans MT42)
MTTNPTASEHSLSIEVVSIMSQVVYGSVGNSIAVPLLQRHGLAVAAVPTVVFSNTPHYPT
LHGGAIPVDWFAGYLDDLLARDALLQLRAVVVGFLGNRAQMDALLCWWNRLRSERPDVIL
IVDPVMGDHDHGVYVDEDLVSAYREAMAAQATGLTPNGFELAKLTGLPVDGIGEVAKAAR
TLLGEQTRWVVVTSAAPMTCSADEMTIVAVTREGEYVFSHPRLPLSPKGTGDLFTASLTA
QLVAAAPLETAVTRAFQDVLGVLRATRAARCAELVLPRFPSMELADR