Protein Info for LRK55_RS08410 in Rhodanobacter denitrificans MT42

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 69 to 95 (27 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 262 (173 residues), 66.9 bits, see alignment E=1e-22

Best Hits

Swiss-Prot: 43% identical to ARAQ_BACHD: L-arabinose transport system permease protein AraQ (araQ) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K10190, lactose/L-arabinose transport system permease protein (inferred from 72% identity to psu:Psesu_1286)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>LRK55_RS08410 carbohydrate ABC transporter permease (Rhodanobacter denitrificans MT42)
MSPRRLMKAIINGLLIGGAVVALFPLLWMLSVSFMAPGEASALPPPLLPAHATLGNYREL
FVRAGMGRYLLNSVLVAGAVTALSLVFNLMAGYAFAKLRFAGRERLFRALLGALVIPAQV
AMLPLFLLLKYMGLVNSYAGVVAPALASVFGIFLVRQYARGIPDELLEAARIDGAGEWHI
FTRIVLPLLKPIIVTLAIFTFLAAWNDFMWPLIALTGQEHYTLPIGLASLAREHAQDSEL
MMAGSVVTVLPVLALFLALQRHYLQGLLLGSVKG