Protein Info for LRK55_RS08340 in Rhodanobacter denitrificans MT42

Annotation: diphosphomevalonate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 99 to 123 (25 residues), see Phobius details TIGR01240: diphosphomevalonate decarboxylase" amino acids 4 to 304 (301 residues), 284.7 bits, see alignment E=3.8e-89 PF00288: GHMP_kinases_N" amino acids 88 to 146 (59 residues), 40.8 bits, see alignment E=2.5e-14 PF18376: MDD_C" amino acids 176 to 304 (129 residues), 65.8 bits, see alignment E=4.7e-22

Best Hits

KEGG orthology group: K01597, diphosphomevalonate decarboxylase [EC: 4.1.1.33] (inferred from 53% identity to hoh:Hoch_3408)

Predicted SEED Role

"Diphosphomevalonate decarboxylase (EC 4.1.1.33)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 4.1.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>LRK55_RS08340 diphosphomevalonate decarboxylase (Rhodanobacter denitrificans MT42)
MAATAQAQPNIALVKYWGKRDTRLNLPVTGSLSITLDALWTRTRVEFDASLRHDELRLNG
AEDPATLARASACLDLLRRRAGTAQRARIDTRNNFPTAAGLASSASGFAALVVAADAALG
LALDRRTLSMLARQGSGSAARSLFGGFVSMAAGQRDDGADAVAQPLLGAAAWPLAVVVAV
TSDRRKHVGSGAGMERSRRTSPFYPAWVDSAATDLAAAQRAVQARDFAALAELSEHNCLK
MHAVMQSSRPPLLYWNGATVDCMQRIRALREDAGEQVFFTVDAGAQVKAVCTPDAAPRVA
AALAELPGVAQVLSSRLGEGARRLDDSEAP