Protein Info for LRK55_RS08340 in Rhodanobacter denitrificans MT42

Annotation: diphosphomevalonate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01240: diphosphomevalonate decarboxylase
  • amino acids 4 to 304 (301 residues), 284.7 bits, E=3.8e-89
• PF00288: GHMP_kinases_N
  • amino acids 88 to 146 (59 residues), 40.8 bits, E=2.5e-14
• PF18376: MDD_C
  • amino acids 176 to 304 (129 residues), 65.8 bits, E=4.7e-22

Best Hits

KEGG orthology group: K01597, diphosphomevalonate decarboxylase [EC: 4.1.1.33] (inferred from 53% identity to hoh:Hoch_3408)

Predicted SEED Role

"Diphosphomevalonate decarboxylase (EC 4.1.1.33)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 4.1.1.33)

MetaCyc Pathways

• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (9/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (6/7 steps found)
• isoprene biosynthesis II (engineered) (6/8 steps found)
• superpathway of ergosterol biosynthesis I (8/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)
• superpathway of cholesterol biosynthesis (8/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.33

Protein Sequence (330 amino acids)

>LRK55_RS08340 diphosphomevalonate decarboxylase (Rhodanobacter denitrificans MT42)
MAATAQAQPNIALVKYWGKRDTRLNLPVTGSLSITLDALWTRTRVEFDASLRHDELRLNG
AEDPATLARASACLDLLRRRAGTAQRARIDTRNNFPTAAGLASSASGFAALVVAADAALG
LALDRRTLSMLARQGSGSAARSLFGGFVSMAAGQRDDGADAVAQPLLGAAAWPLAVVVAV
TSDRRKHVGSGAGMERSRRTSPFYPAWVDSAATDLAAAQRAVQARDFAALAELSEHNCLK
MHAVMQSSRPPLLYWNGATVDCMQRIRALREDAGEQVFFTVDAGAQVKAVCTPDAAPRVA
AALAELPGVAQVLSSRLGEGARRLDDSEAP