Protein Info for LRK55_RS08290 in Rhodanobacter denitrificans MT42

Annotation: ATP-dependent protease subunit HslV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 4 to 176 (173 residues), 93.5 bits, E=6.7e-31
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 7 to 178 (172 residues), 276.2 bits, E=4.5e-87

Best Hits

Swiss-Prot: 77% identical to HSLV_METCA: ATP-dependent protease subunit HslV (hslV) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 77% identity to mca:MCA2014)

MetaCyc: 73% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Protein Sequence (178 amino acids)

>LRK55_RS08290 ATP-dependent protease subunit HslV (Rhodanobacter denitrificans MT42)
MESFHATTIVCVRREGRVVIGSDGQVTLGNTVMKGNARKVRRLGKAGDVVAGFAGATADA
FTLFELFEQKLEKHNSNLTRAAVEMAKEWRTDRRFGRLEAMLAVADKEASLLISGNGDVV
EPEHGLIAIGSGGPFAQSAAMALLENTELDARTIVEKALKIAGDICIYTNHNVSIEEL