Protein Info for LRK55_RS08015 in Rhodanobacter denitrificans MT42

Annotation: PQQ-dependent sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF23500: DUF7133" amino acids 22 to 349 (328 residues), 56.8 bits, see alignment E=2.5e-19 PF07995: GSDH" amino acids 128 to 350 (223 residues), 58.7 bits, see alignment E=6.3e-20

Best Hits

KEGG orthology group: None (inferred from 65% identity to gdj:Gdia_1425)

Predicted SEED Role

"Glucose/sorbosone dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>LRK55_RS08015 PQQ-dependent sugar dehydrogenase (Rhodanobacter denitrificans MT42)
MRLLLPLLLVLSSLPALAAPPLQRLSLPKGFHVALYADQVPDARELALGAKGTVFVGSND
AGKVYALTDANGDGVAERVRVIASGLELPVGVAFKGGDLYVSAVSRIVVLRDIENHLDDP
PKPAVVTDKLPTEAHHGWKFIAFGPDGKLYVPIGAPCNICDPAPAHGKLIRMNVDGSDWQ
DVARGIRNTVGFDWQPGTQRLWFTDNGRDLLGDDLPSDELNEITGPGQHFGYPYCHQGDT
LDPEFGRGKRCKDYVPPVLKLGAHVAALGMRFYEGKQFPASYRGAILVAEHGSWNRTKKS
GYRVMTVRLHGSKVLSYEPLITGFEQNESAWGRPADVQPLPDGSVLVSDDLAGAVYRVTY
KP