Protein Info for LRK55_RS07885 in Rhodanobacter denitrificans MT42

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 372 (333 residues), 266.7 bits, see alignment E=1.2e-83 PF16576: HlyD_D23" amino acids 63 to 291 (229 residues), 63.5 bits, see alignment E=2.6e-21 PF13533: Biotin_lipoyl_2" amino acids 65 to 109 (45 residues), 44.3 bits, see alignment 1.8e-15 PF13437: HlyD_3" amino acids 176 to 281 (106 residues), 30 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 34% identical to BEPF_BRUSU: Efflux pump periplasmic linker BepF (bepF) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: None (inferred from 49% identity to pap:PSPA7_2745)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>LRK55_RS07885 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter denitrificans MT42)
MKKQWMLVLLVAAGAFGSWLLLHGNDSRAQSPAGGPPPEVTVAQALTRQVSDSAEFTGRL
EAVNTVQVQPRVGGFVESVHFQEGALVHKGDVLFQLDARPYQAEVDRLVANQAQAKAELS
LAETNQRRAEMLLAQHAIAQQEADRQATTAQSARAQLGAATAALAAARLNLDFTQVRSPI
DGRVSNARVTPGNLVTSSDVLTSVVSVNPVYVYFDVDEQSWLKLDHLRASAKQAGRNARI
EAAMGLADETGYPHDGRLDFVDNQLHSGSGTMRLRAVFDNADGLYTPGLYARVQLQSGQA
RPRVLVDDRAIGTDLGNQFVYVVDKEHKVQYRKVDTGALFHGLRVIDSGLGANDVVVVNG
LQRVRPGVEVNPQKVAMSYRLDSADKALVERGDAPDADARTAQAGTTAPQSRPQG