Protein Info for LRK55_RS07255 in Rhodanobacter denitrificans MT42

Annotation: tryptophan-rich sensory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details PF03073: TspO_MBR" amino acids 15 to 154 (140 residues), 160.1 bits, see alignment E=1.5e-51

Best Hits

KEGG orthology group: K07185, tryptophan-rich sensory protein (inferred from 70% identity to net:Neut_1064)

Predicted SEED Role

"tryptophan-rich sensory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>LRK55_RS07255 tryptophan-rich sensory protein (Rhodanobacter denitrificans MT42)
MSGMKQIIGLIGWLLLSFSAATIGSIASIQAAAFYRQLAQPTWAPPSAVFGPVWSLLYAL
MGIAAWLVWREGDGRRQRDVLALFVLQLAINALWSWLFFGWHRGALAFADIVLLWLLIGA
TVIGFWRVRPLAGALLLPYLGWVSFASALNYAVWQLNPQILG