Protein Info for LRK55_RS07115 in Rhodanobacter denitrificans MT42

Annotation: isochorismatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 14 to 186 (173 residues), 116.9 bits, E=5.6e-38

Best Hits

Swiss-Prot: 40% identical to NICF_PSEPK: Maleamate amidohydrolase (nicF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 55% identity to cwo:Cwoe_3971)

MetaCyc: 40% identical to maleamate amidohydrolase (Pseudomonas putida KT2440)
RXN-646 [EC: 3.5.1.107]

Predicted SEED Role

"N-carbamoylsarcosine amidase (EC 3.5.1.59)" (EC 3.5.1.59)

MetaCyc Pathways

• creatinine degradation II (2/5 steps found)
• nicotinate degradation I (2/6 steps found)
• nicotinate degradation II (1/5 steps found)
• picolinate degradation (1/7 steps found)
• nicotine degradation III (VPP pathway) (3/10 steps found)
• nicotine degradation II (pyrrolidine pathway) (2/11 steps found)
• superpathway of nicotinate degradation (2/18 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.107 or 3.5.1.59

Protein Sequence (196 amino acids)

>LRK55_RS07115 isochorismatase family protein (Rhodanobacter denitrificans MT42)
MLESRALTPARRYALILVDLSVGFTDPGRSQLGFDCPQVIAANQRLLASFRARGAPVFYT
TVAYDDAAQARVFREKLPVLNCLVAGSALVAIDARVQPAPGEIVIVKRGASGFFGTDLGE
RLRAAGVDGVVVGGLTTSGCVRATALDALQSDLRVLIPRQAVGDRDAAAHESNLHDLHLK
YADVGELDDCLAILDA