Protein Info for LRK55_RS06500 in Rhodanobacter denitrificans MT42

Annotation: LTA synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details PF00884: Sulfatase" amino acids 257 to 495 (239 residues), 116 bits, see alignment E=1.1e-37

Best Hits

Predicted SEED Role

"Capsular polysaccharide biosynthesis protein WcbQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>LRK55_RS06500 LTA synthase family protein (Rhodanobacter denitrificans MT42)
MPLNSAHPLAHWRVVVPRVGLLLLLALAFVLLTGLLDGGIGVTPLRLFDQARYPLANAWP
GLLLAGLLLAISRRALLSFALAFLLQGLLYAVNVLKVANLGTPLLPDDFRIVGQLHKGGM
HILSGYLPHSPWPYLGLLAAVALIVAAWRLEPPLFARRTRGARLLGGSVQALALASMLVG
LPAWAKVYNAKTLWLEPWSTISTTTHSGLVSALMLFHLEYGKGEHKPDRAEAARLIEQST
PALLQSMQAPGAAGELPDIVVVQSESFFDPSIMRGYEHSNFAPNLRRLAAHGSSGKLHVP
TFGGGTIRTEFEFLTGLSLRYFDNLQFPYLQMSHKALPGLVRTLSRHGYSTLALHGNDPA
FWNRTAAFKAIGFDRFVSQSSFPPTAANDGKYMADSAMTDEIMAQLKDDGPPQFIFAISI
EAHGPYDVEPARIAERDAIPVPEGIEGRDKLELQTYLYHLKHADAELGRLVKLLAQRQRP
SVVLFYGDHLPALSNSYQIAGFVDGGDMLGQAGVWLLVDPKHPGKRRTTDTASWLLPGKL
LAHVGIHDDPYFALTELVGPQLAALTEAPGAPPLAEGDAQQQLDQAMASIDQLRMKDKLD
SLLPRPAAPAATGALAHGDAAPGPSSAAVR