Protein Info for LRK55_RS06060 in Rhodanobacter denitrificans MT42

Annotation: glycoside hydrolase family 30 beta sandwich domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF02055: Glyco_hydro_30" amino acids 94 to 428 (335 residues), 147.4 bits, see alignment E=8.2e-47 PF17189: Glyco_hydro_30C" amino acids 431 to 492 (62 residues), 48.6 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: K01201, glucosylceramidase [EC: 3.2.1.45] (inferred from 51% identity to rfr:Rfer_1106)

Predicted SEED Role

"glycosyl hydrolase, family 30"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>LRK55_RS06060 glycoside hydrolase family 30 beta sandwich domain-containing protein (Rhodanobacter denitrificans MT42)
MRDERTGVPGWLALASFALITLLAWLALVPPRVHFAVEGGVILVPPPPEAAVRLWLSTAD
RRLRLARQPDIEPSAGEPSSADVVVDIDRKYQSIVGFGAALTDSSAWLLQNRLNAPQRAA
LLRELFGPPPGLNFNMTRLTIGASDFSLQPYTLDDLPAGDTDPQLLHFNVAANLQDVIPS
VRETLSVNPQLRIIASPWSAPAWMKTSANLIGGGLLEQFESTYADYLVKYVDTYRSYGIP
IFALTLQNEPAFVPLTYPGMELPPATRARIIAQYLGPALAQRSPKTLILGWDHNWDQPDQ
PLGVLGDLDAERYVDGIAWHCYSGSPYAQGQVHRAFPAKDTYITECSGGDWESARNGELL
WFTRDLLLVGLRQWARGIVYWNLALDEQHGPHLGGCDLCKGVVTIDSRTGEVSRNDEYYA
FAHFSRFVLPGAVRVRSSDTDKGLANVAFQNAAGGSVVLVMVNSEAQPRRVTVVQEQTRF
HYTLPAQSVATFEWKPRRPERSANAAPASPASTAPAGTPPGGGAG