Protein Info for LRK55_RS05890 in Rhodanobacter denitrificans MT42

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details PF03006: HlyIII" amino acids 15 to 209 (195 residues), 130.8 bits, see alignment E=3.2e-42 TIGR01065: channel protein, hemolysin III family" amino acids 17 to 216 (200 residues), 193.5 bits, see alignment E=1.6e-61

Best Hits

Swiss-Prot: 48% identical to HLY3_BACCE: Hemolysin-3 from Bacillus cereus

KEGG orthology group: K11068, hemolysin III (inferred from 60% identity to dpr:Despr_0591)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>LRK55_RS05890 hemolysin III family protein (Rhodanobacter denitrificans MT42)
MSATSGTVIPRYSFGDELASIIIHGLGIVLSIAGLATLVAFAALHGNALTVVACAVFGTS
LVLLYTASTLYHSISVAAAKPALRMLDHIAIYVLIAGTYTPFTLVALPGAWGWSLFVAVW
ALALAGSALELGLLKRYHKLAVLLYVGMGWIGMVAFKPLSEHLQTGGTALLLAGGLAYTL
GVPFYLWRRLPYHHALWHVFVLAGSVLHFLAVLLYVIPDPA