Protein Info for LRK55_RS05605 in Rhodanobacter denitrificans MT42

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 14 to 145 (132 residues), 165 bits, E=1.7e-52
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 22 to 360 (339 residues), 357.4 bits, E=5.5e-111
• PF00903: Glyoxalase
  • amino acids 169 to 278 (110 residues), 55.9 bits, E=8.8e-19
• PF13669: Glyoxalase_4
  • amino acids 181 to 275 (95 residues), 38.9 bits, E=1.5e-13

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 82% identity to xca:xccb100_0470)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (4/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Protein Sequence (361 amino acids)

>LRK55_RS05605 4-hydroxyphenylpyruvate dioxygenase (Rhodanobacter denitrificans MT42)
MNAQPNPGMQVTTFENPMGIDGFEFVEFAAPAGRAHELHALFRRMGFSAVLRHKSRPITV
YRQNGVNLLVNEDPDSFAADFAAQHGPSACGFAIRFRKPVAEVEARVLGNGGEAVTHKPA
SRAIGVPVVKGIGDCMLYLVPREGDAYAADYAPIPGAEQNPKGFGLTFIDHLTHNLHFGN
MQKWSDYYEKLFNFREIRYFDIKGAKTGLVSKAMTAPDGIVRIPLNESSDPKSQINEYLD
AYHGEGIQHIACFTDDIYATVEAMRDAGVEFLDTPDAYFEVIDVRVPNHGEDVPRLARNK
ILIDADPETKQRKLLQIFTQNAIGPIFFEIIQRKGNEGFGEGNFQALFESIERDQMKRGF
L