Protein Info for LRK55_RS05050 in Rhodanobacter denitrificans MT42

Annotation: HigA family addiction module antitoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 TIGR02607: addiction module antidote protein, HigA family" amino acids 11 to 87 (77 residues), 97.3 bits, see alignment E=1.8e-32 PF01381: HTH_3" amino acids 25 to 72 (48 residues), 33 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 50% identical to VAPI_DICNO: Virulence-associated protein I (vapI) from Dichelobacter nodosus

KEGG orthology group: None (inferred from 65% identity to geb:GM18_1267)

Predicted SEED Role

"HigA protein (antitoxin to HigB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>LRK55_RS05050 HigA family addiction module antitoxin (Rhodanobacter denitrificans MT42)
MSIHATTNGLSPIHPGELLEEILSDHGMSQAAFARAIGVSPMRISHVIREERPVTAELAL
RFGRAFGQSPQFWMNMQTDYDLKIAERELKASLRKVLPLAA