Protein Info for LRK55_RS04655 in Rhodanobacter denitrificans MT42

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 19 to 434 (416 residues), 490.2 bits, see alignment E=2.7e-151 PF04052: TolB_N" amino acids 28 to 132 (105 residues), 102.5 bits, see alignment E=2.7e-33 PF07676: PD40" amino acids 210 to 233 (24 residues), 33 bits, see alignment (E = 8.6e-12) amino acids 249 to 269 (21 residues), 22.3 bits, see alignment (E = 2e-08) amino acids 287 to 322 (36 residues), 54.1 bits, see alignment 2.1e-18

Best Hits

Swiss-Prot: 48% identical to TOLB_METFK: Tol-Pal system protein TolB (tolB) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>LRK55_RS04655 Tol-Pal system beta propeller repeat protein TolB (Rhodanobacter denitrificans MT42)
MRKFSPSFAAILLAVVALFAGPAAAQSLNVDIVGGVKTATPIVVVPFAQAGGAPLSTDVA
DVMRNDFNRSGKFRSLAKSDIVEFPSRGQDIKFPTWRLLKQDYIVVGNITDAGNGMVQVE
YELWDVNKQQSLLHQQMPPTPLGDLRGVAHQIADIIYQKITGVRGAFWTRIAYITAVGLG
NHTTYSLIVADSDGYNPQVVARSKESLLTPAWSPDGRKLAYVSFESGNSSIYVQDITTGS
RQLVESHPRGINGAPAWSPDGSKLAVALSYVGNLELFVLDVASRRETRLTNSLSIDTEPV
WAPDGQSIYFTSDRSGRPQIYQVPASGGTPQRISFQGQSNLNADVSYDGKQIAMVQGNGN
VYRIAIMDRSLGDQVRFLSPGPIDESPSFAPNASMLLYAATEGRRGVLYAVSADGLVRQR
LVLSDGDVREPAWGPYRQR