Protein Info for LRK55_RS04510 in Rhodanobacter denitrificans MT42

Annotation: Fe2+-dependent dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13640: 2OG-FeII_Oxy_3
  • amino acids 84 to 174 (91 residues), 45.6 bits, E=1.2e-15
• PF18331: PKHD_C
  • amino acids 182 to 223 (42 residues), 25.5 bits, 1.1e-09

Best Hits

Swiss-Prot: 48% identical to Y1482_SYNP6: PKHD-type hydroxylase syc1482_d (syc1482_d) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 48% identity to syf:Synpcc7942_0015)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Protein Sequence (224 amino acids)

>LRK55_RS04510 Fe2+-dependent dioxygenase (Rhodanobacter denitrificans MT42)
MIICAPNVLTAEELGTIRSELQGATFVDGASTAGWSAREVKKNLQVDIDTESQARLREIV
RSAFLRNAMLQASMLPSAMTQVLFNRYDVGMQYGRHVDAPVMGGLGGAVRTDVAITVFLS
DPTSYTGGDLVVDTNGVEYGFKLDAGSAIAYPANSLHHVTPVTQGTRHAAIIWVQSQVRD
AARRELLWDLDNAKRQVFGREGKSATFDAISKSHANLLRMWAEV