Protein Info for LRK55_RS04435 in Rhodanobacter denitrificans MT42

Annotation: peptide deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01327: Pep_deformylase
  • amino acids 2 to 161 (160 residues), 157.9 bits, E=8e-51
• TIGR00079: peptide deformylase
  • amino acids 27 to 160 (134 residues), 114.3 bits, E=2.1e-37

Best Hits

Swiss-Prot: 77% identical to DEF2_PSEPK: Peptide deformylase 2 (def2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 79% identity to pen:PSEEN4003)

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Protein Sequence (179 amino acids)

>LRK55_RS04435 peptide deformylase (Rhodanobacter denitrificans MT42)
MIREILKMGDPRLLRIAPLVPAAMLGSAELDALIADMFETMQAADGVGLAAPQIGVDLQL
VIFGFEHSERYPDAPEVPRTILLNPVITPLSQDMEEGWEGCLSVPGLRGAVNRYTLIRYE
GIDPQGARIDRRAEGFHARVVQHECDHLIGRLYPSRITDFSKFGYTEVLFPGQELADDW