Protein Info for LRK55_RS04390 in Rhodanobacter denitrificans MT42

Annotation: transcriptional regulator NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 147 (147 residues), 202.7 bits, see alignment E=1.4e-64 PF03477: ATP-cone" amino acids 51 to 136 (86 residues), 65.6 bits, see alignment E=2.5e-22

Best Hits

Swiss-Prot: 72% identical to NRDR_STRM5: Transcriptional repressor NrdR (nrdR) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 72% identity to smt:Smal_0576)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>LRK55_RS04390 transcriptional regulator NrdR (Rhodanobacter denitrificans MT42)
MHCPFCQHEDTRVIDSRLTEDGSSVRRRRECEQCGERFNTFETAELKLPAIVKSGERREM
FDERKLRVSFERALQKRPVASDAVDAAVRAIVNDLRRSSEREVPSRQVGELVMRELKKLD
QVAYVRFASVYRKFEDVHAFREEIEKLERDLPGLADLQLPLLGGGKRAGK