Protein Info for LRK55_RS04330 in Rhodanobacter denitrificans MT42

Annotation: NAD(P)-dependent alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 29 to 135 (107 residues), 91.2 bits, E=7.4e-30
• PF01262: AlaDh_PNT_C
  • amino acids 166 to 240 (75 residues), 24.8 bits, E=2.7e-09
• PF00107: ADH_zinc_N
  • amino acids 177 to 299 (123 residues), 83.4 bits, E=2.7e-27
• PF13602: ADH_zinc_N_2
  • amino acids 209 to 333 (125 residues), 36.1 bits, E=2.4e-12

Best Hits

Swiss-Prot: 58% identical to AHR_ECOLI: Aldehyde reductase Ahr (ahr) from Escherichia coli (strain K12)

KEGG orthology group: K12957, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 67% identity to nmu:Nmul_A1400)

MetaCyc: 58% identical to NADPH-dependent aldehyde reductase Ahr (Escherichia coli K-12 substr. MG1655)
Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.2]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• heterolactic fermentation (15/18 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• mixed acid fermentation (12/16 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• ethanol degradation I (1/2 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• ethanolamine utilization (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-methionine degradation III (1/3 steps found)
• pyruvate fermentation to ethanol I (1/3 steps found)
• pyruvate fermentation to ethanol III (1/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• salidroside biosynthesis (1/4 steps found)
• serotonin degradation (3/7 steps found)
• glycerol degradation to butanol (9/16 steps found)
• phenylethanol biosynthesis (1/5 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Alkaloid biosynthesis I
• Caprolactam degradation
• Carotenoid biosynthesis - General
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Insect hormone biosynthesis
• Metabolism of xenobiotics by cytochrome P450
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Retinol metabolism
• Trinitrotoluene degradation
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1

Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.2

Protein Sequence (335 amino acids)

>LRK55_RS04330 NAD(P)-dependent alcohol dehydrogenase (Rhodanobacter denitrificans MT42)
MSSITGWAASAAGQPLKLTTFDVGELGAEEVEVAVDYCGICHSDLSMIGNEWGGSRYPFI
PGHEVVGRVVALGAQAKGLSIGQRVGIGWTAESCMHCRPCLSGDHNLCAQSVATIGGHHG
GFADKLRAHWAWTIPLPEGIDPASAGPLLCGGITVLKPFLAYDIKPTARVGVVGIGGLGH
MAVKFAAAWGCEVTAFTSTAAKADEARSFGAHRVVASRDSDAIKTIAGSLDLLLVTVNVA
MDWNALLGTLAPKGRMHVVGAVLEPIPVPAFSLIGKQREVSGSPTGSPVDIARMLDFAAR
HDIRPQVEMFPLAQVNEALQHLADGKARYRIVLQA