Protein Info for LRK55_RS04220 in Rhodanobacter denitrificans MT42

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 169 (149 residues), 109.3 bits, E=2.5e-35
• PF13304: AAA_21
  • amino acids 67 to 203 (137 residues), 29.9 bits, E=5.5e-11

Best Hits

Swiss-Prot: 48% identical to YVRO_BACSU: Uncharacterized ABC transporter ATP-binding protein YvrO (yvrO) from Bacillus subtilis (strain 168)

KEGG orthology group: K02003, (no description) (inferred from 75% identity to xcb:XC_3665)

MetaCyc: 43% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Protein Sequence (238 amino acids)

>LRK55_RS04220 ABC transporter ATP-binding protein (Rhodanobacter denitrificans MT42)
MLKMTHLSKVYRTEVVETYALRDFNIDVKEGEFVAVTGPSGSGKTTFLTIAGLLETFSGG
EYHLDGIEVSNLNDNARSKIRNEKIGFIFQAFNLIPDLNVFDNIEVPLRYRGMKAAERKQ
RIMDSLERVGLASRARHYPAELSGGQQQRVAIARALAGSPRLLLADEPTGNLDTQMARGV
MELLEDIHREGATIVMVTHDPELAARAQRNVHIIDGQVVDLSEDPRFHTVHAAEEAHG