Protein Info for LRK55_RS04125 in Rhodanobacter denitrificans MT42

Annotation: phosphatidylcholine/phosphatidylserine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 42 to 58 (17 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 17 to 171 (155 residues), 65.9 bits, see alignment E=2.9e-22

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 58% identity to xcb:XC_3594)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>LRK55_RS04125 phosphatidylcholine/phosphatidylserine synthase (Rhodanobacter denitrificans MT42)
MSEPPPVRPPRHRGIYLLPNLFTTGAMFAGFYAIIASIGGRYTEAAVAVFIAALLDGMDG
RVARMTGTQTEFGVQYDSLSDLVSFGLAPALVMYTWSLSALRDFGPLWGKLGWAAAFIYA
ACAALRLARFNTQVGVADKRYFQGLASPAAAAVCMSFVWSVDKFGLAGSDFCFITPVIAI
VVGLLMVSRFRYFSFKSLPMGDRQRVPFVWMVVAVLLLALLILDTPRVLFAGFTLYLLSG
PVWTIWSLATHRRRVRRSAA