Protein Info for LRK55_RS04050 in Rhodanobacter denitrificans MT42

Annotation: secondary thiamine-phosphate synthase enzyme YjbQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 18 to 145 (128 residues), 137 bits, see alignment E=1.6e-44 PF01894: UPF0047" amino acids 26 to 143 (118 residues), 137.9 bits, see alignment E=8.5e-45

Best Hits

Swiss-Prot: 46% identical to Y1880_SYNY3: UPF0047 protein sll1880 (sll1880) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 60% identity to hoh:Hoch_6559)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>LRK55_RS04050 secondary thiamine-phosphate synthase enzyme YjbQ (Rhodanobacter denitrificans MT42)
MTRALPAEHVAQGSFTVHTRGRGFSEITTEVGDAVAASHVQTGIAHVFTAHTSCSLLISE
NADPTVRDDLERWFARAVPDGDAIFRHDAEGPDDMPAHVRSILNGVSLSVPVHGGKPMLG
AWQGIYLWEHRLDPHQRKVVVTVLGN