Protein Info for LRK55_RS03990 in Rhodanobacter denitrificans MT42

Annotation: aspartate carbamoyltransferase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 6 to 151 (146 residues), 152.1 bits, E=1.2e-48
• TIGR00670: aspartate carbamoyltransferase
  • amino acids 6 to 306 (301 residues), 296.1 bits, E=1.3e-92
• PF00185: OTCace
  • amino acids 158 to 302 (145 residues), 80.1 bits, E=2e-26

Best Hits

Swiss-Prot: 54% identical to PYRB_HALHL: Aspartate carbamoyltransferase (pyrB) from Halorhodospira halophila (strain DSM 244 / SL1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 54% identity to hha:Hhal_0941)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Protein Sequence (308 amino acids)

>LRK55_RS03990 aspartate carbamoyltransferase catalytic subunit (Rhodanobacter denitrificans MT42)
MSPRLRHLTSLENLPRETIERLLDRAESLRDACAHGTRKLDVLAGRTVLNLFFEPSTRTR
TSFELAARRLGADVINFDIGLSSTSKGEELFDTLHTLEAMHLDAIVVRHKQSGTPDMLVR
HAMSGVSVINAGDGNRAHPTQGLLDALTIRQHRPDFDKLSVLICGDIKHSRVARSDLNAF
TALGVKEIRLCGPAELMLPADEAPQIRRYGNFDEAIEGVDAVIMLRLQKERMASIELPDE
AAYFAHYGLDRRRLGLAAPGCLVMHPGPINRGIEIASDVADGAQSRILEQVGNGVFVRMA
VLNEVLAR