Protein Info for LRK55_RS03870 in Rhodanobacter denitrificans MT42

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 28 to 174 (147 residues), 127.1 bits, E=4e-41

Best Hits

Swiss-Prot: 58% identical to YBBA_SHIFL: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Shigella flexneri

KEGG orthology group: K02003, (no description) (inferred from 69% identity to psu:Psesu_0736)

MetaCyc: 49% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Protein Sequence (233 amino acids)

>LRK55_RS03870 ATP-binding cassette domain-containing protein (Rhodanobacter denitrificans MT42)
MSDSSRPLLEARDVSKSVNGPEGRLEILSQVSLQVQPGESFAIVGASGSGKTTLLGLLAG
LDTPDGGSIALDGHALQQLDEEARADLRRRLVGFVFQSFHLLPALTAEENVMLPLELEGS
SDARQRARAALDAVGLGARRRHYPAQLSGGEQQRVAIARAFVHRPRVLFADEPTGNLDQR
TGHHVCDLLFALNRDHHTTLVLVTHDAALAARCDRRIELEEGRVVSTGTDVPA