Protein Info for LRK55_RS02990 in Rhodanobacter denitrificans MT42

Annotation: CopD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details PF03653: UPF0093" amino acids 2 to 149 (148 residues), 125.3 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 64% identity to smt:Smal_1248)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>LRK55_RS02990 CopD family protein (Rhodanobacter denitrificans MT42)
MTYLLIKSLHLLFVIAWMATVFYLPRILVNLAEAANEPAVLARLQLMGRRLYKFGHNMFG
IAFLFGLTLWQGWRVFPQTLPNVTAGTHWIDAKLTLVAVLLAYFVWAGRMLKRSEKGDAL
PSSRALRWLNEPPVLLLLAVIWLVLAKPF