Protein Info for LRK55_RS02890 in Rhodanobacter denitrificans MT42

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00072: Response_reg" amino acids 4 to 115 (112 residues), 89.3 bits, see alignment E=3.8e-29 PF00196: GerE" amino acids 139 to 194 (56 residues), 56.7 bits, see alignment E=2.9e-19 PF08281: Sigma70_r4_2" amino acids 140 to 182 (43 residues), 28.5 bits, see alignment 2e-10 PF04545: Sigma70_r4" amino acids 140 to 182 (43 residues), 28.9 bits, see alignment 1.4e-10

Best Hits

Swiss-Prot: 50% identical to DESR_BACSU: Transcriptional regulatory protein DesR (desR) from Bacillus subtilis (strain 168)

KEGG orthology group: K07693, two-component system, NarL family, response regulator DesR (inferred from 86% identity to smt:Smal_0258)

Predicted SEED Role

"Two-component system regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>LRK55_RS02890 response regulator transcription factor (Rhodanobacter denitrificans MT42)
MIRVLLAEDQAMVRGALSALLNLESDIEVLGSAADGEAAWRELQRLKPDVLVTDIEMPGL
TGLELAQRIQRHELPIKVVIVTTFARPGFLRRALDAGVSGYLLKDAPAENLAEALRTVHR
GGRAIDPQLALEAWSEADPLNDRERQVLRLAGEGQSAGDIAAQLNLSHGTVRNYLSEAIG
KLGVANRIEAYRLARQKGWL