Protein Info for LRK55_RS02715 in Rhodanobacter denitrificans MT42

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 34 to 183 (150 residues), 118 bits, E=5e-38

Best Hits

Swiss-Prot: 42% identical to LOLD_ALIF1: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K02003, (no description) (inferred from 69% identity to dac:Daci_0127)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Protein Sequence (250 amino acids)

>LRK55_RS02715 ABC transporter ATP-binding protein (Rhodanobacter denitrificans MT42)
MHPAPVAEPLGTPALQAENVSKAFVSGHQRTQVLDHFSLSIDAGELTLISGPSGCGKSTL
LAILSGLQKVDSGRVRALGSELGQLDLRALERFRLQHTGFVFQGFNLFPALSAFEQVELP
LNHMGLSRDEARRRAQQSLEEVGLAHRMQLRPSELSGGEKQRVAIARALAKQPELLFADE
PTSALDAANGQIIIDILHRIAHTHGTTVLCVSHDPRLVVHADRVLAMEDGRILSDRRNRA
AVIDSKENPA