Protein Info for LRK55_RS02660 in Rhodanobacter denitrificans MT42

Annotation: M20 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF01546: Peptidase_M20" amino acids 93 to 464 (372 residues), 67.8 bits, see alignment E=1.3e-22 PF07687: M20_dimer" amino acids 205 to 363 (159 residues), 25.1 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 72% identity to psu:Psesu_1085)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>LRK55_RS02660 M20 family metallopeptidase (Rhodanobacter denitrificans MT42)
MDTARLSRYVSGLWDDEIVPQLVEYIRIPNKSPMFDKDWVAHGYMDAAVRLMETWARSKL
SQLPGATLEVVRLEGRTPLIYIEVPGQGDDTVMLYGHLDKQPEMTGWADGLGPWTPVLKG
DKLYGRGGADDGYAIFGSLAALLALHEQGVPHARCVVMIEACEESGSYDLPFYVDHLAAR
IGSPSLVVCLDSGCGNYDQLWLTTSLRGMTGGNLSVQVLEEGVHSGDASGVVPSSFRILR
ELLSRLEDPETGTIKPKELYVEIPPQRIEQAKLSAEVLGEDIYSKFPWAEGMQPVTKDLA
ELVLNRTWRPQLAVTGIGGIPPLESAGNVLRPFTAVKLSLRVPPTLNGAKAGEFVKQLLE
KDPPYGAKVSFTLEKDGSGWNAPALSPWLERAVADASQNYFGAPVACMGEGGSIPFMGML
GEKFPKAQFLITGVLGPHSNAHGPNEFLHIPTGKKVSMVVAEVVAKHFKQG