Protein Info for LRK55_RS02340 in Rhodanobacter denitrificans MT42
Annotation: Rid family hydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K15067, 2-aminomuconate deaminase [EC: 3.5.99.5] (inferred from 64% identity to kko:Kkor_0381)Predicted SEED Role
"Bona fide RidA/YjgF/TdcF/RutC subgroup"
MetaCyc Pathways
- L-tryptophan degradation III (eukaryotic) (11/15 steps found)
- 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (3/4 steps found)
- 2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (3/5 steps found)
- L-tryptophan degradation IX (8/12 steps found)
- 2-aminophenol degradation (2/4 steps found)
- 2-nitrobenzoate degradation I (4/7 steps found)
- L-tryptophan degradation XII (Geobacillus) (7/12 steps found)
- L-tryptophan degradation XI (mammalian, via kynurenine) (12/23 steps found)
- 4-nitrotoluene degradation II (1/9 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.99.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (143 amino acids)
>LRK55_RS02340 Rid family hydrolase (Rhodanobacter denitrificans MT42) MSSDSIRTDAAPAPVGAYPHARRVGNLLFLSGVGPRQPGSNAIPGNVHDADGRLAGYDIE AQCRQVFANVRAVLEASGARWEDLVDVTVFLTDMQRDFAAYNRLYAEYFAGVDACRTTVG IDALPTPIAIELKCIAALPAPPH