Protein Info for LRK55_RS02060 in Rhodanobacter denitrificans MT42

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 6 to 140 (135 residues), 29.2 bits, E=2.8e-10
• PF13673: Acetyltransf_10
  • amino acids 39 to 142 (104 residues), 28.1 bits, E=3.5e-10
• PF00583: Acetyltransf_1
  • amino acids 42 to 139 (98 residues), 70.5 bits, E=2.9e-23
• PF13508: Acetyltransf_7
  • amino acids 54 to 140 (87 residues), 50.5 bits, E=4.4e-17

Best Hits

Swiss-Prot: 46% identical to YJGM_SALTY: Uncharacterized N-acetyltransferase YjgM (yjgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 68% identity to mxa:MXAN_6424)

MetaCyc: 46% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

"Histone acetyltransferase HPA2"

Protein Sequence (162 amino acids)

>LRK55_RS02060 GNAT family N-acetyltransferase (Rhodanobacter denitrificans MT42)
MTHDYTIRPIEPRDDAAVAAIIRAVMPEFGAGGPGFAIHDLEVDHMHAAYAQPRCSYFVV
ERDGVVIGGGGIAPLEGGEPDVCELRKMYFLPTARGIGAGTAMMQRCLDAARAHGFKRCY
LETLTGMDAAQALYKRSGFTALCSAMGGTGHHGCDRYFIREL