Protein Info for LRK55_RS01990 in Rhodanobacter denitrificans MT42

Annotation: signal peptidase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 45 to 61 (17 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 7 to 157 (151 residues), 141.2 bits, see alignment E=1.4e-45 PF01252: Peptidase_A8" amino acids 14 to 156 (143 residues), 144.4 bits, see alignment E=1.4e-46

Best Hits

Swiss-Prot: 57% identical to LSPA_XANC8: Lipoprotein signal peptidase (lspA) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 56% identity to psu:Psesu_0977)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>LRK55_RS01990 signal peptidase II (Rhodanobacter denitrificans MT42)
MTPKPNALPWLWLSAAVIVLDQLSKWWALHALQPVGVPHPVIPGFLNWTLAFNTGAAFSF
LADGAGWQRWFFVLLAVAISAVLVGWLRRTPRRDWRTALPLALIVGGAVGNLIDRLHAAQ
VTDFIHVYFRQWSYPVFNLADCGITVGAVMLIAFGLFAGKPGNGVR