Protein Info for LRK55_RS01795 in Rhodanobacter denitrificans MT42

Annotation: DUF2058 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF09831: DUF2058" amino acids 4 to 179 (176 residues), 188 bits, see alignment E=8.4e-60

Best Hits

Swiss-Prot: 43% identical to YAIL_ECOLI: Uncharacterized protein YaiL (yaiL) from Escherichia coli (strain K12)

KEGG orthology group: K09912, hypothetical protein (inferred from 63% identity to xom:XOO_3584)

Predicted SEED Role

"nucleoprotein/polynucleotide-associated enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>LRK55_RS01795 DUF2058 domain-containing protein (Rhodanobacter denitrificans MT42)
MRNPLQEQLLKAGLVNKAKAAQVVREQAKKHQGKAPVAPSAEELEARRLQAEKAERDRAI
AAERNAQARANEARAQVRQIVEAHKVKREGEIAYRFTDGDRIKDVLVNEPLRAQLAAGTL
VIVRYGEGYELLPRVAADKIRERDATMIVLDHGRTEAGSSSGADDEYYRQFEVPDDLIW