Protein Info for LRK55_RS01735 in Rhodanobacter denitrificans MT42

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF19335: HMBD" amino acids 51 to 76 (26 residues), 24.6 bits, see alignment (E = 5e-09) PF16576: HlyD_D23" amino acids 111 to 318 (208 residues), 189.1 bits, see alignment E=1.6e-59 PF16572: HlyD_D4" amino acids 157 to 211 (55 residues), 28.5 bits, see alignment 2.9e-10 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 168 to 392 (225 residues), 130.9 bits, see alignment E=2.6e-42 PF13533: Biotin_lipoyl_2" amino acids 213 to 244 (32 residues), 28.5 bits, see alignment (E = 2.6e-10) PF13437: HlyD_3" amino acids 214 to 308 (95 residues), 61.9 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 47% identity to pzu:PHZ_p0222)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>LRK55_RS01735 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter denitrificans MT42)
MKRPLIVLAAVAAAAALLVAGYLGGRRQAAVAPSSTPASTAAAADAGKVLYWYDPMLPEQ
HFDKPGLSPMGMQMVPRYADGGGADESVVRIDPATVQNLGVRIVPVERRVLSTTLHVPGT
VTWNPREAITVSARVDAVVSQLHVRAPYTRVAAGEPLAELLAPQWSSALAEYDALQGAQS
ADAKALRRAARERLQVLGLTAADIRAAHAAGPITLHAAQAGTVTALEVREGQRVGAGQTL
MTLNGLATVWVEASLPQAIAGTVRAGTPVTVTVDAFPGQVFRGSVETLLPEVDSATRTQR
ARIVLANLDGRLSPGLFATVQLQPAEGGAVPVVPSDALIATGAQTRVIVAEAGGRFRPLA
VRTGRSADGYTEILDGLHGGEKVVVSGQFLIDSEASLSGALERLGAEQVVPAAAASAAPP
ATSHDAHAGHAMPSGGQP