Protein Info for LRK55_RS01495 in Rhodanobacter denitrificans MT42

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01296: aspartate-semialdehyde dehydrogenase
  • amino acids 8 to 340 (333 residues), 464.3 bits, E=1.1e-143
• PF01118: Semialdhyde_dh
  • amino acids 8 to 122 (115 residues), 119.1 bits, E=1.6e-38
• PF02774: Semialdhyde_dhC
  • amino acids 143 to 325 (183 residues), 206.1 bits, E=5.3e-65

Best Hits

Swiss-Prot: 61% identical to DHAS_SHEVD: Aspartate-semialdehyde dehydrogenase (asd) from Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 74% identity to xal:XALc_0981)

MetaCyc: 51% identical to aspartate semialdehyde dehydrogenase subunit (Bacillus subtilis)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Protein Sequence (343 amino acids)

>LRK55_RS01495 aspartate-semialdehyde dehydrogenase (Rhodanobacter denitrificans MT42)
MSQKSSYKVAMVGATGAVGETVLAILAEREFPVSELVPLASERSAGGKVKFGGKDVTVQL
LDTYDFAGVDIAFFSAGGSVSREHAPRAAAAGAVVIDNTSEFRYQDDIPLVISEVNPHAI
AQYTTRGIIANPNCSTMQMLVALAPIHRAVQIERINVATYQSVSGAGRSGMEELGRETAA
LLNFQSVEPGKKFPAQIAFNVIPQIDDFQPNGYTKEEMKLVWETRKILEDESIQVNPTAV
RVPVFYGHSEAVHIETSDKITADEARELLRQAPGVVLVDERKPGGYPTPVGEAAGTDAVY
VGRIREDISHERGLDLWIVSDNIRKGAALNAVQIAELLIEDYL