Protein Info for LRK55_RS01410 in Rhodanobacter denitrificans MT42

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 32 to 305 (274 residues), 263.9 bits, see alignment E=8.4e-83 PF01545: Cation_efflux" amino acids 34 to 225 (192 residues), 152.4 bits, see alignment E=6.7e-49

Best Hits

Swiss-Prot: 42% identical to ZITB_SALTY: Zinc transporter ZitB (zitB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 49% identity to mlo:mll2984)

MetaCyc: 45% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>LRK55_RS01410 cation diffusion facilitator family transporter (Rhodanobacter denitrificans MT42)
MNTAHADRHAHAHDGDHGYAHDPTAASGSRGRKLLLAFGLTAAMMAVEVAGGAWSGSLAL
LADAGHMVVDALALLLAIVGARVAIRPADARRSYGYGRMEVLAGFVNALGQFVLVGWIVY
EAGVRLLHPGEILSGIMLVVAIAGLLVNALVLRTLHGHAHDDVNLAGASLHVLGDLLGSL
AAVLAALAIRWFGWLWADPVLSLLISLLILGSAWRLLRVSAHILLEGVPDGMDSALVEAS
LRTADPGIRDIHHLHVWQLASGSRMATVHAELAECADGAQALQAIKRMLLERFGIQHVTV
QIDPGSCLDASEDCAGHGHR